Immunogen: Fusion protein amino acids 121-363 (C-terminus) of mouse Homer1L (also known as Homer protein homolog 1, VASP/Ena-related gene up-regulated during seizure and LTP 1, Vesl-1, Vesl, SYN47 and PSD-Zip45, accession number Q9Z2Y3)
Rat: 97% identity (236/243 amino acids identical) Human: 93% identity (226/243 amino acids identical) <30% identity with Homer1S (100% identity between amino acids 121-175, shared sequence of MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFPH) <40% identity with Homer2