Molecular Weight: 4830.57Salt Form: TFAPurity: >95%Sequence (3-letter): Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2Sequence (1-letter): YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2Storage: -20 °C or below
Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis. CRF [Tyr0] has an N-terminal Tyr added which can be radiolabeled with I-125.
Categories | Peptides |
---|
Filter | Neuropeptides & Hormones |
---|